PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_67158.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family HSF
Protein Properties Length: 63aa    MW: 6555.43 Da    PI: 4.5854
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_67158.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind51.52.9e-161263253
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHH CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSF 53
                  F+ k+y +++d++++ ++ w   +nsfvv d+  f++ +Lp +Fkh nf+SF
  MLOC_67158.1 12 FVAKTYGMVDDPATDAVVAWGPASNSFVVADPFAFSEMLLPAHFKHANFSSF 63
                  9********************999***************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004151.7E-4863IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.104.5E-18963IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467853.94E-14963IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000569.4E-101235IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004476.3E-131263IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.4E-105062IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MSSAGGGMVA PFVAKTYGMV DDPATDAVVA WGPASNSFVV ADPFAFSEML LPAHFKHANF  60
SSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3636102e-96AK363610.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2017E20.
GenBankAK3690022e-96AK369002.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2083K01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451825.17e-27hypothetical protein SORBIDRAFT_04g008300
SwissprotQ6EUG48e-28HFC2A_ORYSJ; Heat stress transcription factor C-2a
TrEMBLF2DI924e-36F2DI92_HORVD; Predicted protein
TrEMBLM0YA203e-38M0YA20_HORVD; Uncharacterized protein
STRINGMLOC_67158.18e-38(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24520.18e-25heat shock transcription factor C1